Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200 Peptide - C-terminal region

CD200 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MRC, MOX1, MOX2, OX-2

UniProt

P41217

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD200 Rabbit Polyclonal Antibody (orb589620) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001004196.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDRGELSQGVQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Kynurenine 3-monooxygenase (KMO) ELISA Kit
MBS7252237-01 48 Well

Chicken Kynurenine 3-monooxygenase (KMO) ELISA Kit

Sign In for Pricing
View Details
Chicken Kynurenine 3-monooxygenase (KMO) ELISA Kit
MBS7252237-02 96 Well

Chicken Kynurenine 3-monooxygenase (KMO) ELISA Kit

Sign In for Pricing
View Details
Chicken Kynurenine 3-monooxygenase (KMO) ELISA Kit
MBS7252237-03 5x 96 Well

Chicken Kynurenine 3-monooxygenase (KMO) ELISA Kit

Sign In for Pricing
View Details
Chicken Kynurenine 3-monooxygenase (KMO) ELISA Kit
MBS7252237-04 10x 96 Well

Chicken Kynurenine 3-monooxygenase (KMO) ELISA Kit

Sign In for Pricing
View Details
MAK, CT (MAK, Serine/threonine-protein kinase MAK, Male germ cell-associated kinase) (FITC)
MBS6318113-01 0.2 mL

MAK, CT (MAK, Serine/threonine-protein kinase MAK, Male germ cell-associated kinase) (FITC)

Sign In for Pricing
View Details
MAK, CT (MAK, Serine/threonine-protein kinase MAK, Male germ cell-associated kinase) (FITC)
MBS6318113-02 5x 0.2 mL

MAK, CT (MAK, Serine/threonine-protein kinase MAK, Male germ cell-associated kinase) (FITC)

Sign In for Pricing
View Details