CAMKK2 Peptide - C-terminal region
CAMKK2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CAMKK, CAMKKB
UniProt
Q96RR4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CAMKK2 Rabbit Polyclonal Antibody (orb589821) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001257414.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LTKKPTRECESLSELKEARQRRQPPGHRPAPRGGGGSALVRGSPCVESCW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402848-500 1x 500 µL
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940304-500 1x 500 µL
CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470385-500 1x 500 µL
CD3e (Rabbit PAb), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details