Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLCO2A1 Peptide - N-terminal region

SLCO2A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PGT, MATR1, PHOAR2, OATP2A1, SLC21A2

UniProt

Q92959

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLCO2A1 Rabbit Polyclonal Antibody (orb55818) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005621.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASQGSDTSTSRAGRCARSVFGNIKVFVLCQGLLQLCQLLYSAYFKSSLTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ETS2 Protein Lysate (Human) with C-Ha Tag
19529031 100 µg

ETS2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
CD19 peptide
orb374710 1 mg

CD19 peptide

Sign In for Pricing
View Details
Desmin (DES) Antibody
abx013058-01 10 µg

Desmin (DES) Antibody

Sign In for Pricing
View Details
Desmin (DES) Antibody
abx013058-02 100 µg

Desmin (DES) Antibody

Sign In for Pricing
View Details
Desmin (DES) Antibody
abx013058-03 200 µg

Desmin (DES) Antibody

Sign In for Pricing
View Details
Desmin (DES) Antibody
abx013058-04 300 µg

Desmin (DES) Antibody

Sign In for Pricing
View Details