PLCB3 Peptide - middle region
PLCB3 Peptide - middle region
Product Specifications
UniProt
Q01970
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLCB3 Rabbit Polyclonal Antibody (orb589936) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000923.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: APGVPLPSPQDLMGRILVKNKKRHRPSAGGPDSAGRKRPLEQSNSALSES
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
038739-ML490 100 µL
MYLIP, ID (MYLIP, BZF1, IDOL, E3 ubiquitin-protein ligase MYLIP, Inducible degrader of the LDL-receptor, Myosin regulatory light chain interacting protein) (MaxLight 490) discontinued
Sign In for Pricing
View Details EK342699 96 Well
Rat FGF7/KGF (Fibroblast Growth Factor 7) ValidElisa Kit
Sign In for Pricing
View Details 
GTR15372088 1 Vial
Lentiviral human SEMA5A sgRNA gene knockout kit - Lentiviral human SEMA5A sgRNA gene knockout kit (100)
Sign In for Pricing
View Details 
MBS6368791-01 0.1 mL
ADAM12 (Disintegrin and Metalloproteinase Domain-containing Protein 12, ADAM 12, Meltrin-alpha, MLTN, UNQ346/PRO545) (AP)
Sign In for Pricing
View Details MBS6368791-02 5x 0.1 mL
ADAM12 (Disintegrin and Metalloproteinase Domain-containing Protein 12, ADAM 12, Meltrin-alpha, MLTN, UNQ346/PRO545) (AP)
Sign In for Pricing
View Details