SNX3 Peptide - N-terminal region
SNX3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
SDP3, Grd19, MCOPS8
UniProt
O60493
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SNX3 Rabbit Polyclonal Antibody (orb589537) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001287858.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040050-500 1x 500 µL
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472760-100 1x 100 µL
BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2760), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940918-500 1x 500 µL
CD44 Standard (HCAM/918), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881748-100 1x 100 µL
Ubiquitin (Autophagy Marker) (UBB/1748), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details