Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNG Peptide - middle region

IFNG Peptide - middle region

Product Specifications

Product Name Alternative

IFG, IFI

UniProt

P01579

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFNG Rabbit Polyclonal Antibody (orb589587) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000610.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Anti-Human CD20-PE conjugate
CD20P-100 100 Tests

Mouse Monoclonal Anti-Human CD20-PE conjugate

Sign In for Pricing
View Details
FANCI antibody
FNab03009 100 µg

FANCI antibody

Sign In for Pricing
View Details
CYB5R3 Rabbit Polyclonal Antibody (Cy5)
orb921668 100 µL

CYB5R3 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Mmu-miR-6913-5p miRNA Mimic
orb1874874-01 5 nmol

Mmu-miR-6913-5p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-6913-5p miRNA Mimic
orb1874874-02 10 nmol

Mmu-miR-6913-5p miRNA Mimic

Sign In for Pricing
View Details
anti-FBXL5
YF-PA18259 50 ug

anti-FBXL5

Sign In for Pricing
View Details