Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNG Peptide - middle region

IFNG Peptide - middle region

Product Specifications

Product Name Alternative

IFG, IFI

UniProt

P01579

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFNG Rabbit Polyclonal Antibody (orb589587) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000610.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Unc13a sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4221704 1.0 µg DNA

Unc13a sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
CD278/ICOS Rabbit Polyclonal Antibody
orb2952111-01 50 µg

CD278/ICOS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD278/ICOS Rabbit Polyclonal Antibody
orb2952111-02 100 µg

CD278/ICOS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phyto Yeast Extract Glucose Agar (YDC Medium)
PHM022-500G 500 g

Phyto Yeast Extract Glucose Agar (YDC Medium)

Sign In for Pricing
View Details
USP9YP36 Protein Vector (Human) (pPB-N-His)
PV142467 500 ng

USP9YP36 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Membrane-bound Transcription Factor Site-1 Protease, Recombinant, Human, aa218-414, His-SUMO-Tag
585369-01 20 µg

Membrane-bound Transcription Factor Site-1 Protease, Recombinant, Human, aa218-414, His-SUMO-Tag

Sign In for Pricing
View Details