CD79B Peptide - C-terminal region
CD79B Peptide - C-terminal region
Product Specifications
Product Name Alternative
B29, IGB, AGM6
UniProt
P40259
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD79B Rabbit Polyclonal Antibody (orb589631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000617.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSV030320-01 100 µg
Recombinant SARS-CoV-2 Spike RBD (E484K) (His Tag)
Sign In for Pricing
View Details PKSV030320-02 1 mg
Recombinant SARS-CoV-2 Spike RBD (E484K) (His Tag)
Sign In for Pricing
View Details 
