CD79B Peptide - C-terminal region
CD79B Peptide - C-terminal region
Product Specifications
Product Name Alternative
B29, IGB, AGM6
UniProt
P40259
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD79B Rabbit Polyclonal Antibody (orb589631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000617.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042378-500 1x 500 µL
P21WAF1 (Tumor Suppressor Protein) (AC8), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC402985 20 µg
FATP3 (SLC27A3) (NM_024330) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC882259-500 1x 500 µL
Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 