Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DRD3 Peptide - N-terminal region

DRD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

D3DR, ETM1, FET1

UniProt

P35462

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DRD3 Rabbit Polyclonal Antibody (orb589634) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000787.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPL / TPOR / CD110 Reference Antibody (TA136)
orb1817877 100 µg

MPL / TPOR / CD110 Reference Antibody (TA136)

Sign In for Pricing
View Details
NSUN4 Rabbit pAb
E45R21537N-100 100 µL

NSUN4 Rabbit pAb

Sign In for Pricing
View Details
TIMP-4 Polyclonal Antibody
orb1410978 100 µL

TIMP-4 Polyclonal Antibody

Sign In for Pricing
View Details
PPM1F Peptide - C-terminal region
MBS3247390-01 0.1 mg

PPM1F Peptide - C-terminal region

Sign In for Pricing
View Details
PPM1F Peptide - C-terminal region
MBS3247390-02 5x 0.1 mg

PPM1F Peptide - C-terminal region

Sign In for Pricing
View Details
Anti-MIA3 Antibody Picoband® (Dylight488 Conjugate)
A06158-1-Dylight488 100 µg

Anti-MIA3 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details