Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DRD3 Peptide - N-terminal region

DRD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

D3DR, ETM1, FET1

UniProt

P35462

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DRD3 Rabbit Polyclonal Antibody (orb589634) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000787.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat MYO10 shRNA Plasmid
abx989589-01 150 µg

Rat MYO10 shRNA Plasmid

Sign In for Pricing
View Details
Rat MYO10 shRNA Plasmid
abx989589-02 300 µg

Rat MYO10 shRNA Plasmid

Sign In for Pricing
View Details
PELO (NM_015946) Human Untagged Clone
SC320778 10 µg

PELO (NM_015946) Human Untagged Clone

Sign In for Pricing
View Details
MT-TI Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV734373 1.0 µg DNA

MT-TI Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
HSP 90α Lentiviral Activation Particles (m)
sc-420981-LAC 200 µL

HSP 90α Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Rabbit Monoclonal CD3 epsilon Antibody (OKT-3 (muromonab)) [Allophycocyanin]
NBP2-81031APC 0.1 mL

Rabbit Monoclonal CD3 epsilon Antibody (OKT-3 (muromonab)) [Allophycocyanin]

Sign In for Pricing
View Details