Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DRD3 Peptide - N-terminal region

DRD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

D3DR, ETM1, FET1

UniProt

P35462

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DRD3 Rabbit Polyclonal Antibody (orb589634) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000787.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Cell death activator CIDE-3(CIDEC)
AP76771-01 20 µg

Recombinant Human Cell death activator CIDE-3(CIDEC)

Sign In for Pricing
View Details
Recombinant Human Cell death activator CIDE-3(CIDEC)
AP76771-02 100 µg

Recombinant Human Cell death activator CIDE-3(CIDEC)

Sign In for Pricing
View Details
Recombinant Human Cell death activator CIDE-3(CIDEC)
AP76771-03 1 mg

Recombinant Human Cell death activator CIDE-3(CIDEC)

Sign In for Pricing
View Details
S100A9 Protein, Human, Recombinant
TMPY-01330-01 5 µg

S100A9 Protein, Human, Recombinant

Sign In for Pricing
View Details
S100A9 Protein, Human, Recombinant
TMPY-01330-02 10 µg

S100A9 Protein, Human, Recombinant

Sign In for Pricing
View Details
S100A9 Protein, Human, Recombinant
TMPY-01330-03 20 µg

S100A9 Protein, Human, Recombinant

Sign In for Pricing
View Details