Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAD2L1 Peptide - middle region

MAD2L1 Peptide - middle region

Product Specifications

Product Name Alternative

MAD2, HSMAD2

UniProt

Q13257

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAD2L1 Rabbit Polyclonal Antibody (orb589635) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002349.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Involucrin (IVRN/827), CF568 conjugate, 0.1mg/mL
BNC680827-500 1x 500 µL

Involucrin (IVRN/827), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (124), Biotin conjugate, 0.1mg/mL
BNCB0530-100 1x 100 µL

Bcl-2 (124), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Optional tube holder, 12x5ml tubes
D2400-R5V2 1 Each

Optional tube holder, 12x5ml tubes

Sign In for Pricing
View Details
RANTES (CCL5) Rabbit Polyclonal Antibody
AP20618PU-N 100 µg

RANTES (CCL5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Salbutamol Acetonide
TRC-S085530-50MG 50 mg

Salbutamol Acetonide

Sign In for Pricing
View Details
RASGRP3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G7]
TA801465BM 100 µL

RASGRP3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G7]

Sign In for Pricing
View Details