Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAD2L1 Peptide - middle region

MAD2L1 Peptide - middle region

Product Specifications

Product Name Alternative

MAD2, HSMAD2

UniProt

Q13257

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAD2L1 Rabbit Polyclonal Antibody (orb589635) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002349.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gas2 activation kit by CRISPRa
GA201547 1 Kit

Mouse Gas2 activation kit by CRISPRa

Sign In for Pricing
View Details
Sprr4 Mouse Gene Knockout Kit (CRISPR)
KN516666 1 Kit

Sprr4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Troglitazone
TRC-T892500-5MG 5 mg

Troglitazone

Sign In for Pricing
View Details
FEZ2 (NM_001042548) Human Over-expression Lysate
LC420977 20 µg

FEZ2 (NM_001042548) Human Over-expression Lysate

Sign In for Pricing
View Details
Tm4sf19 Mouse Gene Knockout Kit (CRISPR)
KN517640 1 Kit

Tm4sf19 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD47 / IAP (Integrin Associated Protein) (CD47/2937), CF405S conjugate, 0.1mg/mL
BNC042937-500 1x 500 µL

CD47 / IAP (Integrin Associated Protein) (CD47/2937), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details