Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSB Peptide - middle region

CTSB Peptide - middle region

Product Specifications

Product Name Alternative

APPS, CPSB

UniProt

P07858

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTSB Rabbit Polyclonal Antibody (orb589639) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001899.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Veratridine
SIH-300-50MG 50 mg

Veratridine

Sign In for Pricing
View Details
CT47A2 (NM_001080145) Human Over-expression Lysate
LC421601 20 µg

CT47A2 (NM_001080145) Human Over-expression Lysate

Sign In for Pricing
View Details
S100A1 (Melanoma Marker) (S100A1/1942), CF405S conjugate, 0.1mg/mL
BNC041942-100 1x 100 µL

S100A1 (Melanoma Marker) (S100A1/1942), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NeuN (RBFOX3) Human Gene Knockout Kit (CRISPR)
KN424826 1 Kit

NeuN (RBFOX3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elaiophylin (>85%)
TRC-E501003-2.5MG 2.5 mg

Elaiophylin (>85%)

Sign In for Pricing
View Details
Recombinant MAT1A Antibody
RC-4692-01 50 μL

Recombinant MAT1A Antibody

Sign In for Pricing
View Details