Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSB Peptide - middle region

CTSB Peptide - middle region

Product Specifications

Product Name Alternative

APPS, CPSB

UniProt

P07858

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTSB Rabbit Polyclonal Antibody (orb589639) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001899.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF568 conjugate, 0.1mg/mL
BNC680032-100 1x 100 µL

MUC2 (CCP58), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyramide Amplification Kit with HRP Streptavidin and CF®680R Tyramide
#33017 1 Kit

Tyramide Amplification Kit with HRP Streptavidin and CF®680R Tyramide

Sign In for Pricing
View Details
1-(4-Formylphenyl)-4-piperidinecarboxylic Acid
TRC-B594025-500MG 500 mg

1-(4-Formylphenyl)-4-piperidinecarboxylic Acid

Sign In for Pricing
View Details
Mouse Talin (TLN) ELISA Kit
RDR-TLN-Mu-01 96 Tests

Mouse Talin (TLN) ELISA Kit

Sign In for Pricing
View Details
Mouse Talin (TLN) ELISA Kit
RDR-TLN-Mu-02 48 Tests

Mouse Talin (TLN) ELISA Kit

Sign In for Pricing
View Details
BMP 2 Human, HEK
OM296918-01 10 µg

BMP 2 Human, HEK

Sign In for Pricing
View Details