Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDM1A Peptide - middle region

KDM1A Peptide - middle region

Product Specifications

Product Name Alternative

AOF2, CPRF, KDM1, LSD1, BHC110

UniProt

O60341

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KDM1A Rabbit Polyclonal Antibody (orb589640) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001009999.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Col5a3 Mouse shRNA Plasmid (Locus ID 53867)
TR502966 1 Kit

Col5a3 Mouse shRNA Plasmid (Locus ID 53867)

Sign In for Pricing
View Details
Hey L (HEYL) (NM_014571) Human Tagged ORF Clone
RG202851 10 µg

Hey L (HEYL) (NM_014571) Human Tagged ORF Clone

Sign In for Pricing
View Details
EIF2D Knockout SK-HEP-1 Polyclonal Cells
ARG41004 1 Million

EIF2D Knockout SK-HEP-1 Polyclonal Cells

Sign In for Pricing
View Details
RPL17P39 CRISPR All-in-one AAV vector set (with saCas9)(Human)
40903151 3x 1.0 µg DNA

RPL17P39 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Human INHBC Recombinant Protein
PPT-13419 100 µg

Human INHBC Recombinant Protein

Sign In for Pricing
View Details
COA8 Human Pre-designed siRNA Set A
HY-RS02945 1 Set

COA8 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details