Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDM1A Peptide - middle region

KDM1A Peptide - middle region

Product Specifications

Product Name Alternative

AOF2, CPRF, KDM1, LSD1, BHC110

UniProt

O60341

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KDM1A Rabbit Polyclonal Antibody (orb589640) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001009999.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calorimeter, Double Wall, Aluminum
1060770 1 Each

Calorimeter, Double Wall, Aluminum

Sign In for Pricing
View Details
Myeloperoxidase (MPO) Antibody (Biotin)
abx105689-01 20 µg

Myeloperoxidase (MPO) Antibody (Biotin)

Sign In for Pricing
View Details
Myeloperoxidase (MPO) Antibody (Biotin)
abx105689-02 50 µg

Myeloperoxidase (MPO) Antibody (Biotin)

Sign In for Pricing
View Details
Myeloperoxidase (MPO) Antibody (Biotin)
abx105689-03 100 µg

Myeloperoxidase (MPO) Antibody (Biotin)

Sign In for Pricing
View Details
Myeloperoxidase (MPO) Antibody (Biotin)
abx105689-04 200 µg

Myeloperoxidase (MPO) Antibody (Biotin)

Sign In for Pricing
View Details
Myeloperoxidase (MPO) Antibody (Biotin)
abx105689-05 1 mg

Myeloperoxidase (MPO) Antibody (Biotin)

Sign In for Pricing
View Details