Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTER Peptide - middle region

PTER Peptide - middle region

Product Specifications

Product Name Alternative

HPHRP, RPR-1

UniProt

Q96BW5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTER Rabbit Polyclonal Antibody (orb589641) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001001484.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGTELLHYQLGPDIDMPDDNKRIRRVRLLVEEGCEDRILVAHDIHTKTRL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fidgetin (FIGN) (MaxLight 550)
MBS6269579-01 0.1 mL

Fidgetin (FIGN) (MaxLight 550)

Sign In for Pricing
View Details
Fidgetin (FIGN) (MaxLight 550)
MBS6269579-02 5x 0.1 mL

Fidgetin (FIGN) (MaxLight 550)

Sign In for Pricing
View Details
IKIP Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV813379 1.0 µg DNA

IKIP Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Phospho-CARM1 (Ser228) Rabbit Polyclonal Antibody (Cy3)
orb982355 100 µL

Phospho-CARM1 (Ser228) Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
PPP1R9A Protein Vector (Mouse) (pPM-C-His)
PV218641 500 ng

PPP1R9A Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
TLR5 ELISA Kit (Human)
OKEH01415-96W 96 Well

TLR5 ELISA Kit (Human)

Sign In for Pricing
View Details