Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCAN Peptide - middle region

BCAN Peptide - middle region

Product Specifications

Product Name Alternative

BEHAB, CSPG7

UniProt

Q96GW7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCAN Rabbit Polyclonal Antibody (orb589757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_068767.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PIMEDGGGGSSTPEDPAEAPRTLLEFETQSMVPPTGFSEEEGKALEEEEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycine
TRC-G615990-1G 1 g

Glycine

Sign In for Pricing
View Details
CD4 (T-Helper/Inducer Cell Marker) (CD4/1604), 0.2mg/mL
BNUB1604-100 1x 100 µL

CD4 (T-Helper/Inducer Cell Marker) (CD4/1604), 0.2mg/mL

Sign In for Pricing
View Details
LRRK2 Human Gene Knockout Kit (CRISPR)
KN216373 1 Kit

LRRK2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human GLT25D2 (COLGALT2) activation kit by CRISPRa
GA108057 1 Kit

Human GLT25D2 (COLGALT2) activation kit by CRISPRa

Sign In for Pricing
View Details
Angptl2 Mouse Gene Knockout Kit (CRISPR)
KN501240 1 Kit

Angptl2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Polystyrene A FP
HA40045007.100G 100 g

Polystyrene A FP

Sign In for Pricing
View Details