BCAN Peptide - middle region
BCAN Peptide - middle region
Product Specifications
Product Name Alternative
BEHAB, CSPG7
UniProt
Q96GW7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BCAN Rabbit Polyclonal Antibody (orb589757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_068767.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PIMEDGGGGSSTPEDPAEAPRTLLEFETQSMVPPTGFSEEEGKALEEEEK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB2476-500 1x 500 µL
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2476), 0.2mg/mL
Sign In for Pricing
View Details 
RG239754 10 µg
NFkB p100 / p52 (NFKB2) (NM_001288724) Human Tagged ORF Clone
Sign In for Pricing
View Details 
PKSH032181-01 10 µg
Recombinant Human Cathepsin E/CTSE Protein (His Tag)
Sign In for Pricing
View Details