Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLB1 Peptide - C-terminal region

GLB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EBP, ELNR1, MPS4B

UniProt

P16278

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GLB1 Rabbit Polyclonal Antibody (orb589776) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000395.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), Biotin conjugate, 0.1mg/mL
BNCB0965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PSMD4 (NM_002810) Human Over-expression Lysate
LY400997 100 µg

PSMD4 (NM_002810) Human Over-expression Lysate

Sign In for Pricing
View Details
Isometamidium Chloride Hydrochloride
TRC-I821275-1MG 1 mg

Isometamidium Chloride Hydrochloride

Sign In for Pricing
View Details
Recombinant Mouse CD53 Protein (aa 107-181, His Tag)
PKSM040523 100 µg

Recombinant Mouse CD53 Protein (aa 107-181, His Tag)

Sign In for Pricing
View Details
Galectin 3 Monoclonal Antibody
E-AB-22006-01 20 µL

Galectin 3 Monoclonal Antibody

Sign In for Pricing
View Details
Galectin 3 Monoclonal Antibody
E-AB-22006-02 60 µL

Galectin 3 Monoclonal Antibody

Sign In for Pricing
View Details