Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTK6 Peptide - middle region

PTK6 Peptide - middle region

Product Specifications

Product Name Alternative

BRK

UniProt

Q13882

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTK6 Rabbit Polyclonal Antibody (orb589777) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001243287.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPHWDDWERPREEFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROR2 Mouse Monoclonal Antibody [Clone ID: OTI3F8]
CF810006 100 µg

ROR2 Mouse Monoclonal Antibody [Clone ID: OTI3F8]

Sign In for Pricing
View Details
HK2 Polyclonal Antibody
E-AB-14706-01 20 µL

HK2 Polyclonal Antibody

Sign In for Pricing
View Details
HK2 Polyclonal Antibody
E-AB-14706-02 60 µL

HK2 Polyclonal Antibody

Sign In for Pricing
View Details
HK2 Polyclonal Antibody
E-AB-14706-03 120 µL

HK2 Polyclonal Antibody

Sign In for Pricing
View Details
HK2 Polyclonal Antibody
E-AB-14706-04 200 µL

HK2 Polyclonal Antibody

Sign In for Pricing
View Details
Rassf7 Mouse Gene Knockout Kit (CRISPR)
KN514521 1 Kit

Rassf7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details