PTK6 Peptide - middle region
PTK6 Peptide - middle region
Product Specifications
Product Name Alternative
BRK
UniProt
Q13882
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PTK6 Rabbit Polyclonal Antibody (orb589777) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001243287.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPHWDDWERPREEFT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![APOB48R (APOBR) Mouse Monoclonal Antibody [Clone ID: OTI6A6]](https://cdn.genprice.uk/products/937/68dd18b9061270361e90800c/imageurl/cf807166.webp)
CF807166 100 µg
APOB48R (APOBR) Mouse Monoclonal Antibody [Clone ID: OTI6A6]
Sign In for Pricing
View Details 
BNC681623-500 1x 500 µL
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/1623), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details