Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB2 Peptide - middle region

HSPB2 Peptide - middle region

Product Specifications

Product Name Alternative

MKBP, HSP27, Hs.78846, LOH11CR1K

UniProt

Q16082

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPB2 Rabbit Polyclonal Antibody (orb589778) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001532.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Keratin 9 (KRT9) ELISA Kit
RDR-KRT9-Hu-01 96 Tests

Human Keratin 9 (KRT9) ELISA Kit

Sign In for Pricing
View Details
Human Keratin 9 (KRT9) ELISA Kit
RDR-KRT9-Hu-02 48 Tests

Human Keratin 9 (KRT9) ELISA Kit

Sign In for Pricing
View Details
Tyro3 Mouse shRNA Lentiviral Particle (Locus ID 22174)
TL502358V 500 µL Each

Tyro3 Mouse shRNA Lentiviral Particle (Locus ID 22174)

Sign In for Pricing
View Details
Phospho-RAF1 (S621) Antibody
A40191-100UG 100 µg

Phospho-RAF1 (S621) Antibody

Sign In for Pricing
View Details
Human INPP5J Knockout A549 cell line
GTR15410768 1 Vial

Human INPP5J Knockout A549 cell line

Sign In for Pricing
View Details
N-nitroso Epinephrine
CS-O-39069-10MG 1 Each

N-nitroso Epinephrine

Sign In for Pricing
View Details