HSPB2 Peptide - middle region
HSPB2 Peptide - middle region
Product Specifications
Product Name Alternative
MKBP, HSP27, Hs.78846, LOH11CR1K
UniProt
Q16082
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HSPB2 Rabbit Polyclonal Antibody (orb589778) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001532.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS4503103-01 48 Tests
Human Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) ELISA Kit
Sign In for Pricing
View Details MBS4503103-02 96 Tests
Human Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) ELISA Kit
Sign In for Pricing
View Details MBS4503103-03 5x 96 Tests
Human Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) ELISA Kit
Sign In for Pricing
View Details MBS4503103-04 10x 96 Tests
Human Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) ELISA Kit
Sign In for Pricing
View Details 
