Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STC2 Peptide - N-terminal region

STC2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

STC-2, STCRP

UniProt

O76061

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STC2 Rabbit Polyclonal Antibody (orb589806) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003705.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ATFDPARGTDATNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGR Antibody
MBS7116893-01 0.05 mg

PGR Antibody

Sign In for Pricing
View Details
PGR Antibody
MBS7116893-02 0.1 mg

PGR Antibody

Sign In for Pricing
View Details
PGR Antibody
MBS7116893-03 5x 0.1 mg

PGR Antibody

Sign In for Pricing
View Details
Monoclonal Transglutaminase II (TGM2) Antibody - With BSA and Azide, Clone: TGM2/419
APG01337G 0.05mg

Monoclonal Transglutaminase II (TGM2) Antibody - With BSA and Azide, Clone: TGM2/419

Sign In for Pricing
View Details
Pleiotrophin (PTN) Peptide
abx615474 100 µg

Pleiotrophin (PTN) Peptide

Sign In for Pricing
View Details
Recombinant Human CRK Protein, N-His
orb3153670-01 50 µg

Recombinant Human CRK Protein, N-His

Sign In for Pricing
View Details