Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STC2 Peptide - N-terminal region

STC2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

STC-2, STCRP

UniProt

O76061

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STC2 Rabbit Polyclonal Antibody (orb589806) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003705.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ATFDPARGTDATNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NUDC antibody
PAab05895 100 µg

Anti-NUDC antibody

Sign In for Pricing
View Details
Human PILR-alpha Allophycocyanin Affinity Purified PAb
FAB6484A 100 Tests

Human PILR-alpha Allophycocyanin Affinity Purified PAb

Sign In for Pricing
View Details
JAK1 Human Gene Knockout Kit (CRISPR)
KN213878 1 Kit

JAK1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Bromoisovaleric acid
22255507-100g 100 g

2-Bromoisovaleric acid

Sign In for Pricing
View Details
3D Globe
1140685 1 Each

3D Globe

Sign In for Pricing
View Details
Kcnj15 Mouse qPCR Template Standard (NM_019664)
MK202705 1 Kit

Kcnj15 Mouse qPCR Template Standard (NM_019664)

Sign In for Pricing
View Details