Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRM2 Peptide - N-terminal region

CHRM2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HM2

UniProt

P08172

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHRM2 Rabbit Polyclonal Antibody (orb589810) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000730.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSV1 (Herpes Simplex Virus Type I) (10A3), CF594 conjugate, 0.1mg/mL
BNC941793-500 1x 500 µL

HSV1 (Herpes Simplex Virus Type I) (10A3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human RNF181 activation kit by CRISPRa
GA109680 1 Kit

Human RNF181 activation kit by CRISPRa

Sign In for Pricing
View Details
Amelotin (AMTN) Mouse Monoclonal Antibody [Clone ID: OTI2G5]
CF808520 100 µg

Amelotin (AMTN) Mouse Monoclonal Antibody [Clone ID: OTI2G5]

Sign In for Pricing
View Details
Human LRRC55 activation kit by CRISPRa
GA116497 1 Kit

Human LRRC55 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse Sonic Hedgehog/SHH (C-6His)
PKSM041416-01 10 µg

Recombinant Mouse Sonic Hedgehog/SHH (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse Sonic Hedgehog/SHH (C-6His)
PKSM041416-02 50 µg

Recombinant Mouse Sonic Hedgehog/SHH (C-6His)

Sign In for Pricing
View Details