Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUOX Peptide - middle region

SUOX Peptide - middle region

Product Specifications

UniProt

P51687

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SUOX Rabbit Polyclonal Antibody (orb589946) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000447.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc-L-phenylglycine ≥98.5% (HPLC)
236462-01 5 g

Boc-L-phenylglycine ≥98.5% (HPLC)

Sign In for Pricing
View Details
Boc-L-phenylglycine ≥98.5% (HPLC)
236462-02 25 g

Boc-L-phenylglycine ≥98.5% (HPLC)

Sign In for Pricing
View Details
Boc-L-phenylglycine ≥98.5% (HPLC)
236462-03 100 g

Boc-L-phenylglycine ≥98.5% (HPLC)

Sign In for Pricing
View Details
Boc-L-phenylglycine ≥98.5% (HPLC)
236462-04 250 g

Boc-L-phenylglycine ≥98.5% (HPLC)

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv.viciae Protein CrcB homolog (crcB), partial
MBS7075225 Inquire

Recombinant Rhizobium leguminosarum bv.viciae Protein CrcB homolog (crcB), partial

Sign In for Pricing
View Details
46 kDa Surface Antigen (P46) Antibody (FITC)
abx107756-01 20 µg

46 kDa Surface Antigen (P46) Antibody (FITC)

Sign In for Pricing
View Details