AKR1D1 Peptide - middle region
AKR1D1 Peptide - middle region
Product Specifications
Product Name Alternative
CBAS2, SRD5B1, 3o5bred
UniProt
P51857
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AKR1D1 Rabbit Polyclonal Antibody (orb589950) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001177835.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C7521 96 Tests
Cytochrome c Oxidase assembly protein COX19 (COX19) Bovine ELISA Kit
Sign In for Pricing
View Details