Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYB5R3 Peptide - middle region

CYB5R3 Peptide - middle region

Product Specifications

Product Name Alternative

B5R, DIA1

UniProt

P00387

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYB5R3 Rabbit Polyclonal Antibody (orb589954) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000389.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Direct Extraction Buffer
orb2646461 20 mL

Direct Extraction Buffer

Sign In for Pricing
View Details
Mouse Clcn2 qPCR Primer Pair
QM01886S 200 Tests

Mouse Clcn2 qPCR Primer Pair

Sign In for Pricing
View Details
Human RBP3 protein
orb754065-01 50 µg

Human RBP3 protein

Sign In for Pricing
View Details
Human RBP3 protein
orb754065-02 100 µg

Human RBP3 protein

Sign In for Pricing
View Details
Human RBP3 protein
orb754065-03 200 µg

Human RBP3 protein

Sign In for Pricing
View Details
Human RBP3 protein
orb754065-04 1 mg

Human RBP3 protein

Sign In for Pricing
View Details