PLEKHA1 Peptide - middle region
PLEKHA1 Peptide - middle region
Product Specifications
Product Name Alternative
TAPP1
UniProt
Q9HB21
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLEKHA1 Rabbit Polyclonal Antibody (orb589955) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001001974.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: WVNVLNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPII
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC700391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680460-500 1x 500 µL
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details