Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDHX Peptide - middle region

PDHX Peptide - middle region

Product Specifications

Product Name Alternative

E3BP, OPDX, PDX1, proX, DLDBP

UniProt

O00330

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDHX Rabbit Polyclonal Antibody (orb589959) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001128496.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM101A Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-8229R-BF488 100 µL

FAM101A Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Mouse α Synuclein oligomer Antibody ELISA kit
GTR14673661 96 Well

Mouse α Synuclein oligomer Antibody ELISA kit

Sign In for Pricing
View Details
Horse Peroxiredoxin-2 ELISA Kit
MBS047306-01 48 Well

Horse Peroxiredoxin-2 ELISA Kit

Sign In for Pricing
View Details
Horse Peroxiredoxin-2 ELISA Kit
MBS047306-02 96 Well

Horse Peroxiredoxin-2 ELISA Kit

Sign In for Pricing
View Details
Horse Peroxiredoxin-2 ELISA Kit
MBS047306-03 5x 96 Well

Horse Peroxiredoxin-2 ELISA Kit

Sign In for Pricing
View Details
Horse Peroxiredoxin-2 ELISA Kit
MBS047306-04 10x 96 Well

Horse Peroxiredoxin-2 ELISA Kit

Sign In for Pricing
View Details