Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC22B Peptide - N-terminal region

SEC22B Peptide - N-terminal region

Product Specifications

Product Name Alternative

ERS-24, SEC22L1

UniProt

O75396

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEC22B Rabbit Polyclonal Antibody (orb589960) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004883.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRTM1 Antibody
KC-8252-01 50 μL

LRRTM1 Antibody

Sign In for Pricing
View Details
LRRTM1 Antibody
KC-8252-02 100 µL

LRRTM1 Antibody

Sign In for Pricing
View Details
LRRTM1 Antibody
KC-8252-03 1 mL

LRRTM1 Antibody

Sign In for Pricing
View Details
8-place magnetic tip comb for IsoPure Mini, cs 50
AP1016-MC 1 Each

8-place magnetic tip comb for IsoPure Mini, cs 50

Sign In for Pricing
View Details
Human Solute Carrier Family 1, Member 5 (SLC1A5) ELISA Kit
RDR-SLC1A5-Hu-01 96 Tests

Human Solute Carrier Family 1, Member 5 (SLC1A5) ELISA Kit

Sign In for Pricing
View Details
Human Solute Carrier Family 1, Member 5 (SLC1A5) ELISA Kit
RDR-SLC1A5-Hu-02 48 Tests

Human Solute Carrier Family 1, Member 5 (SLC1A5) ELISA Kit

Sign In for Pricing
View Details