Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC22B Peptide - N-terminal region

SEC22B Peptide - N-terminal region

Product Specifications

Product Name Alternative

ERS-24, SEC22L1

UniProt

O75396

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEC22B Rabbit Polyclonal Antibody (orb589960) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004883.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Drebrin 1 (DBN1) (DBN1/2879), Biotin conjugate, 0.1mg/mL
BNCB2879-100 1x 100 µL

Drebrin 1 (DBN1) (DBN1/2879), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ILF2 Human Gene Knockout Kit (CRISPR)
KN401751 1 Kit

ILF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HCP1 (SLC46A1) Human Gene Knockout Kit (CRISPR)
KN214417BN 1 Kit

HCP1 (SLC46A1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ERGIC1 (NM_001031711) Human Over-expression Lysate
LC422162 20 µg

ERGIC1 (NM_001031711) Human Over-expression Lysate

Sign In for Pricing
View Details
Uncoated Mouse ENG (Endoglin) ELISA Kit
E-UNEL-M0005-01 5x 96 Tests

Uncoated Mouse ENG (Endoglin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse ENG (Endoglin) ELISA Kit
E-UNEL-M0005-02 15x 96 Tests

Uncoated Mouse ENG (Endoglin) ELISA Kit

Sign In for Pricing
View Details