DAP3 Peptide - middle region
DAP3 Peptide - middle region
Product Specifications
Product Name Alternative
DAP-3, MRPS29, MRP-S29, bMRP-10
UniProt
P51398
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DAP3 Rabbit Polyclonal Antibody (orb589962) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001186778.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DQPLEASTWLKNFKTTNERFLNQIKVQEKYVWNKRESTEKGSPLGEVVEQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MHC Class II I-Ek Mouse Monoclonal Antibody [Clone ID: 14-4-4S]](https://cdn.genprice.uk/products/937/68dd18bc061270361e909330/imageurl/cl074p.webp)
CL074P 250 µg
MHC Class II I-Ek Mouse Monoclonal Antibody [Clone ID: 14-4-4S]
Sign In for Pricing
View Details 
