Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAP3 Peptide - middle region

DAP3 Peptide - middle region

Product Specifications

Product Name Alternative

DAP-3, MRPS29, MRP-S29, bMRP-10

UniProt

P51398

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DAP3 Rabbit Polyclonal Antibody (orb589962) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001186778.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DQPLEASTWLKNFKTTNERFLNQIKVQEKYVWNKRESTEKGSPLGEVVEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD158b/j Antibody[DX27]
E-AB-F1381D-01 20 Tests

PE Anti-Human CD158b/j Antibody[DX27]

Sign In for Pricing
View Details
PE Anti-Human CD158b/j Antibody[DX27]
E-AB-F1381D-02 100 Tests

PE Anti-Human CD158b/j Antibody[DX27]

Sign In for Pricing
View Details
PE Anti-Human CD158b/j Antibody[DX27]
E-AB-F1381D-03 2x 100 Tests

PE Anti-Human CD158b/j Antibody[DX27]

Sign In for Pricing
View Details
Rhox9 Mouse Gene Knockout Kit (CRISPR)
KN514809 1 Kit

Rhox9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human HSDL2 activation kit by CRISPRa
GA113460 1 Kit

Human HSDL2 activation kit by CRISPRa

Sign In for Pricing
View Details
Clec3b Mouse Gene Knockout Kit (CRISPR)
KN503442 1 Kit

Clec3b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details