Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD12 Peptide - middle region

KCTD12 Peptide - middle region

Product Specifications

Product Name Alternative

PFET1, PFETIN, C13orf2

UniProt

Q96CX2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCTD12 Rabbit Polyclonal Antibody (orb589965) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_612453.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQADAKFRRVARITVCGKTSLAKEVFGDTLNESRDPDRPPERYTSRYYLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10-Phthalamido-1-decanol
TRC-P382475-500MG 500 mg

10-Phthalamido-1-decanol

Sign In for Pricing
View Details
Optineurin (OPTN) (NM_001008211) Human Over-expression Lysate
LC423390 20 µg

Optineurin (OPTN) (NM_001008211) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD196/CCR6 Antibody[G034E3]
E-AB-F1158Q-01 20 Tests

Elab Fluor® Violet 450 Anti-Human CD196/CCR6 Antibody[G034E3]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD196/CCR6 Antibody[G034E3]
E-AB-F1158Q-02 100 Tests

Elab Fluor® Violet 450 Anti-Human CD196/CCR6 Antibody[G034E3]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD196/CCR6 Antibody[G034E3]
E-AB-F1158Q-03 2x 100 Tests

Elab Fluor® Violet 450 Anti-Human CD196/CCR6 Antibody[G034E3]

Sign In for Pricing
View Details
Recombinant Human CRTAM Protein (Fc Tag)
PDMH100279-01 20 µg

Recombinant Human CRTAM Protein (Fc Tag)

Sign In for Pricing
View Details