Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD12 Peptide - middle region

KCTD12 Peptide - middle region

Product Specifications

Product Name Alternative

PFET1, PFETIN, C13orf2

UniProt

Q96CX2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCTD12 Rabbit Polyclonal Antibody (orb589965) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_612453.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQADAKFRRVARITVCGKTSLAKEVFGDTLNESRDPDRPPERYTSRYYLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (Mucin 2) (rMLP/842), CF647 conjugate, 0.1mg/mL
BNC473609-500 1x 500 µL

MUC2 (Mucin 2) (rMLP/842), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APOB48R (APOBR) Rabbit Polyclonal Antibody
TA368057 100 µL

APOB48R (APOBR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PGA3 (NM_001079807) Human Over-expression Lysate
LY421542 100 µg

PGA3 (NM_001079807) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CCHCR1 activation kit by CRISPRa
GA110161 1 Kit

Human CCHCR1 activation kit by CRISPRa

Sign In for Pricing
View Details
ARMS2 (NM_001099667) Human Recombinant Protein
TP701006 20 µg

ARMS2 (NM_001099667) Human Recombinant Protein

Sign In for Pricing
View Details
Bromo Polystyrene
H12516009.5G 5 g

Bromo Polystyrene

Sign In for Pricing
View Details