LILRA2 Peptide - C-terminal region
LILRA2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ILT1, LIR7, CD85H, LIR-7
UniProt
Q8N149
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LILRA2 Rabbit Polyclonal Antibody (orb589040) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_006857.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SNPYLLSLPSDPLELVVSEAAETLSPSQNKTDSTTTSLGQHPQDYTVENL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740446-500 1x 500 µL
Cytokeratin, HMW (34BE12), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 