Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WISP1 Peptide - middle region

WISP1 Peptide - middle region

Product Specifications

Product Name Alternative

CCN4, WISP1c, WISP1i, WISP1tc

UniProt

O95388

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WISP1 Rabbit Polyclonal Antibody (orb589719) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001191798.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CEQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit 8-Hydroxy-desoxyguanosine,8-OHdG ELISA KIT
E0087Rb-01 48 Well

Rabbit 8-Hydroxy-desoxyguanosine,8-OHdG ELISA KIT

Sign In for Pricing
View Details
Rabbit 8-Hydroxy-desoxyguanosine,8-OHdG ELISA KIT
E0087Rb-02 96 Well

Rabbit 8-Hydroxy-desoxyguanosine,8-OHdG ELISA KIT

Sign In for Pricing
View Details
Rabbit 8-Hydroxy-desoxyguanosine,8-OHdG ELISA KIT
E0087Rb-03 5x 96 Tests

Rabbit 8-Hydroxy-desoxyguanosine,8-OHdG ELISA KIT

Sign In for Pricing
View Details
Rabbit 8-Hydroxy-desoxyguanosine,8-OHdG ELISA KIT
E0087Rb-04 10x 96 Tests

Rabbit 8-Hydroxy-desoxyguanosine,8-OHdG ELISA KIT

Sign In for Pricing
View Details
TG 100801 100mg
A13819-100 100 mg

TG 100801 100mg

Sign In for Pricing
View Details
Transferrin Receptor (CD71)
045717 100 µL

Transferrin Receptor (CD71)

Sign In for Pricing
View Details