Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WISP1 Peptide - middle region

WISP1 Peptide - middle region

Product Specifications

Product Name Alternative

CCN4, WISP1c, WISP1i, WISP1tc

UniProt

O95388

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WISP1 Rabbit Polyclonal Antibody (orb589719) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001191798.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CEQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom2r7 Rat shRNA Lentiviral Particle (Locus ID 685557)
TL704061V 500 µL Each

Vom2r7 Rat shRNA Lentiviral Particle (Locus ID 685557)

Sign In for Pricing
View Details
Human platelet-associated immunoglobulins, PAIg ELISA Kit
SL1421Hu-01 48 Tests

Human platelet-associated immunoglobulins, PAIg ELISA Kit

Sign In for Pricing
View Details
Human platelet-associated immunoglobulins, PAIg ELISA Kit
SL1421Hu-02 96 Tests

Human platelet-associated immunoglobulins, PAIg ELISA Kit

Sign In for Pricing
View Details
CD86 Recombinant Rabbit Monoclonal Antibody (Cy3)
orb2363368 100 µL

CD86 Recombinant Rabbit Monoclonal Antibody (Cy3)

Sign In for Pricing
View Details
CRH (Corticoliberin, Corticotropin-releasing Factor, Corticotropin-releasing Hormone) (AP) discontinued
125330-AP 100 µL

CRH (Corticoliberin, Corticotropin-releasing Factor, Corticotropin-releasing Hormone) (AP) discontinued

Sign In for Pricing
View Details
LRC57 Rabbit Polyclonal Antibody
JOT-AP11128-01 20 µL

LRC57 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details