Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL13A Peptide - middle region

RPL13A Peptide - middle region

Product Specifications

Product Name Alternative

L13A, TSTA1

UniProt

P40429

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL13A Rabbit Polyclonal Antibody (orb589772) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001257420.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor I (CFI) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A8]
TA806031BM 100 µL

Factor I (CFI) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A8]

Sign In for Pricing
View Details
4- (hydroxyimino) -N-phenylpiperidine-1-carboxamide
sc-348343A 5 g

4- (hydroxyimino) -N-phenylpiperidine-1-carboxamide

Sign In for Pricing
View Details
TELO2-interacting protein 2 (TTI2) Antibody
abx346826-01 20 µg

TELO2-interacting protein 2 (TTI2) Antibody

Sign In for Pricing
View Details
TELO2-interacting protein 2 (TTI2) Antibody
abx346826-02 50 µg

TELO2-interacting protein 2 (TTI2) Antibody

Sign In for Pricing
View Details
TELO2-interacting protein 2 (TTI2) Antibody
abx346826-03 100 µg

TELO2-interacting protein 2 (TTI2) Antibody

Sign In for Pricing
View Details
TELO2-interacting protein 2 (TTI2) Antibody
abx346826-04 200 µg

TELO2-interacting protein 2 (TTI2) Antibody

Sign In for Pricing
View Details