Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL13A Peptide - middle region

RPL13A Peptide - middle region

Product Specifications

Product Name Alternative

L13A, TSTA1

UniProt

P40429

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL13A Rabbit Polyclonal Antibody (orb589772) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001257420.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYVN1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2324807 1.0 µg DNA

SYVN1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Gm14632 (NM_001100610) Mouse Tagged ORF Clone
MR202314 10 µg

Gm14632 (NM_001100610) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Anti-PMS2 Antibody (R3N11)
RHF03002 100 μg

Anti-PMS2 Antibody (R3N11)

Sign In for Pricing
View Details
BBS7 CRISPR/Cas9 KO Plasmid (h)
sc-408903 20 µg

BBS7 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
FRA10F Protein Vector (Human) (pPM-C-HA)
PV078903 500 ng

FRA10F Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
GABRB1 (Ab-434) Antibody
A55267-100UL 100 µL

GABRB1 (Ab-434) Antibody

Sign In for Pricing
View Details