Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPA4 Peptide - middle region

RPA4 Peptide - middle region

Product Specifications

Product Name Alternative

HSU24186

UniProt

Q13156

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPA4 Rabbit Polyclonal Antibody (orb590029) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_037479.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P57 / KIP2 (KIP2/880), CF640R conjugate, 0.1mg/mL
BNC400880-500 1x 500 µL

P57 / KIP2 (KIP2/880), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pellino 1 (PELI1) Mouse Monoclonal Antibody [Clone ID: OTI3A9]
CF807607 100 µg

Pellino 1 (PELI1) Mouse Monoclonal Antibody [Clone ID: OTI3A9]

Sign In for Pricing
View Details
CD74 Monoclonal Antibody
AN200025P 100 µL

CD74 Monoclonal Antibody

Sign In for Pricing
View Details
A4GNT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F7]
TA800401BM 100 µL

A4GNT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F7]

Sign In for Pricing
View Details
Tissue FFPE Sections, Testis
CS804141 5x 5 µm

Tissue FFPE Sections, Testis

Sign In for Pricing
View Details
Analytical Balance BBAL-105
BBAL-105 1 Unit

Analytical Balance BBAL-105

Sign In for Pricing
View Details