RPA4 Peptide - middle region
RPA4 Peptide - middle region
Product Specifications
Product Name Alternative
HSU24186
UniProt
Q13156
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RPA4 Rabbit Polyclonal Antibody (orb590029) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_037479.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-EL-H1762-01 24 Tests
Human VASPIN (Visceral Adipose Specific Serine Protease Inhibitor) ELISA Kit
Sign In for Pricing
View Details E-EL-H1762-02 48 Tests
Human VASPIN (Visceral Adipose Specific Serine Protease Inhibitor) ELISA Kit
Sign In for Pricing
View Details E-EL-H1762-03 96 Tests
Human VASPIN (Visceral Adipose Specific Serine Protease Inhibitor) ELISA Kit
Sign In for Pricing
View Details 
AP07592PU-N 50 µg
IL1 Receptor II (IL1R2) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 