USP46 Peptide - middle region
USP46 Peptide - middle region
Product Specifications
UniProt
P62068
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with USP46 Rabbit Polyclonal Antibody (orb590031) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001127695.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PYK2 Recombinant Rabbit Monoclonal Antibody [SC06-15]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81b2c/imageurl/et1610-82.webp)
ET1610-82 100 µL
PYK2 Recombinant Rabbit Monoclonal Antibody [SC06-15]
Sign In for Pricing
View Details 