WIPI1 Peptide - middle region
WIPI1 Peptide - middle region
Product Specifications
Product Name Alternative
ATG18, ATG18A, WIPI49
UniProt
Q5MNZ9
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WIPI1 Rabbit Polyclonal Antibody (orb590040) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_060453.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940204-500 1x 500 µL
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880770-500 1x 500 µL
Cytokeratin 8/18 (C-43 + DC10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941461-100 1x 100 µL
CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402044-500 1x 500 µL
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401731-100 1x 100 µL
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details