PPP1CB Peptide - middle region
PPP1CB Peptide - middle region
Product Specifications
Product Name Alternative
PP1B, PP-1B, PPP1CD, PP1beta, HEL-S-80p
UniProt
P62140
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPP1CB Rabbit Polyclonal Antibody (orb590046) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_002700.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
