Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1CB Peptide - middle region

PPP1CB Peptide - middle region

Product Specifications

Product Name Alternative

PP1B, PP-1B, PPP1CD, PP1beta, HEL-S-80p

UniProt

P62140

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP1CB Rabbit Polyclonal Antibody (orb590046) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002700.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP26113 (ALK inhibitor)
SF5449-10mM 10 mM x 0.2 mL

AP26113 (ALK inhibitor)

Sign In for Pricing
View Details
Apg3 (ATG3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C12]
TA503161AM 100 µL

Apg3 (ATG3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C12]

Sign In for Pricing
View Details
Rbms2 siRNA Oligos set (Rat)
38650176 3x 5 nmol

Rbms2 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Anti-FMO2 Antibody Picoband® (Dylight488 Conjugate)
PB9760-Dylight488 100 µg

Anti-FMO2 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
ACOX1 (m) -PR
sc-140817-PR 10 µM - 20 µL

ACOX1 (m) -PR

Sign In for Pricing
View Details
DHH (desert Hedgehog Homolog (Drosophila), HHG-3, MGC35145) (Biotin)
245319-Biotin 100 µL

DHH (desert Hedgehog Homolog (Drosophila), HHG-3, MGC35145) (Biotin)

Sign In for Pricing
View Details